(data stored in ACNUC7421 zone)

EMBL: CP000667.PE110

CP000667.PE110       Location/Qualifiers
FT   CDS             119237..119755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52595"
FT                   /db_xref="UniProtKB/TrEMBL:A4X145"
FT                   /protein_id="ABP52595.1"
FT                   /translation="MACRHAALFGLRNVTGSGWRYCLRHGCPVRSLPSAEDDEEGGVPE
FT                   SGDAAGPPRRSSRCGPGATAARHRSASGYRRVVGAHRAPGGARPSRGYLLTVALLVGTA
FT                   SMPLLAAAGAGSATRPPSADHSSPPSSAPAVSPPPSLSSASVSPSSPEPSPSLTPSSPR
FT                   ASSPAPAWS"
     MACRHAALFG LRNVTGSGWR YCLRHGCPVR SLPSAEDDEE GGVPESGDAA GPPRRSSRCG        60
     PGATAARHRS ASGYRRVVGA HRAPGGARPS RGYLLTVALL VGTASMPLLA AAGAGSATRP       120
     PSADHSSPPS SAPAVSPPPS LSSASVSPSS PEPSPSLTPS SPRASSPAPA WS               172
//

If you have problems or comments...

PBIL Back to PBIL home page