(data stored in ACNUC7421 zone)

EMBL: CP000667.PE113

CP000667.PE113       Location/Qualifiers
FT   CDS             122017..123858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0113"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52598"
FT                   /db_xref="GOA:A4X148"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X148"
FT                   /protein_id="ABP52598.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREIGTDWFVDIDDKKYTPQEISARTLMKLKRDAE
FT                   AYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVIEVKSTSGDNLLGGDDWDQRIIDHLVKTFNGEHGI
FT                   DLAQDKMAMQRLKEAAEKAKIELSAAATSNINLPYITAGAAGPLHLDVTITRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKVGDVEHVILVGGSTRMPAVTELVKQLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGEREIAAYNKKLGTFELTGLPPAPRGMPQIEVTFDIDANGIVNV
FT                   HAKDTGTGKEQKMTVTAGSSLPKEDIERMRRDAEEHAEEDKQRREEAETRNVAEALQWQ
FT                   TEKFLAESGDKLPTESRDQINEALGELRSALGGQDIEKIKSAHAQLAQVSQQAGSQLYT
FT                   QQQGEQAGATGDQAGAQAGGPDDVVDAEIVDEDKGKK"
     MARAVGIDLG TTNSCVSVLE GGEPTVIANA EGSRTTPSIV AFARNGEVLV GEVAKRQAVT        60
     NPDRTIRSVK REIGTDWFVD IDDKKYTPQE ISARTLMKLK RDAEAYLGEQ ITDAVITVPA       120
     YFNDGQRQAT KEAGEIAGFN VLRIVNEPTA AALAYGLDKG SKEQTVLVFD LGGGTFDVSL       180
     LELAEGVIEV KSTSGDNLLG GDDWDQRIID HLVKTFNGEH GIDLAQDKMA MQRLKEAAEK       240
     AKIELSAAAT SNINLPYITA GAAGPLHLDV TITRAEFQRM TQDLLDRCKG PFEQAVKDAG       300
     IKVGDVEHVI LVGGSTRMPA VTELVKQLTG RDPNKGVNPD EVVAVGAALQ AGVLKGEVKD       360
     VLLLDVTPLS LGIETKGGIF TKLIERNTTI PTKRSEVFTT ADDNQPSVLI QVFQGEREIA       420
     AYNKKLGTFE LTGLPPAPRG MPQIEVTFDI DANGIVNVHA KDTGTGKEQK MTVTAGSSLP       480
     KEDIERMRRD AEEHAEEDKQ RREEAETRNV AEALQWQTEK FLAESGDKLP TESRDQINEA       540
     LGELRSALGG QDIEKIKSAH AQLAQVSQQA GSQLYTQQQG EQAGATGDQA GAQAGGPDDV       600
     VDAEIVDEDK GKK                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page