(data stored in ACNUC7421 zone)

EMBL: CP000667.PE114

CP000667.PE114       Location/Qualifiers
FT   CDS             123902..124699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0114"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52599"
FT                   /db_xref="GOA:A4X149"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A4X149"
FT                   /protein_id="ABP52599.1"
FT                   /translation="MTDKPRATDPDATGSVPGGSASAGEAGAEPRVVIRDNRKISNAAG
FT                   ASSDAAGTGSDSGSDAADADAAAADAGSDVPAAGLVEEADVVVDEIQAETTEGSPVSPP
FT                   VVDAPAEPVDAATATSLGAELEALRADLDERTRDLQRVTAEYANYRKRVDRDRALVTEQ
FT                   ATGSVLAALLPILDDLDRAREHGDLVGPFGSVAEQLTTALGKFGLTPFGAEGDPFDPTQ
FT                   HEAVTHQTSAEVTEPTCVQVMRRGYLVGERLLRPALVGVAEPE"
     MTDKPRATDP DATGSVPGGS ASAGEAGAEP RVVIRDNRKI SNAAGASSDA AGTGSDSGSD        60
     AADADAAAAD AGSDVPAAGL VEEADVVVDE IQAETTEGSP VSPPVVDAPA EPVDAATATS       120
     LGAELEALRA DLDERTRDLQ RVTAEYANYR KRVDRDRALV TEQATGSVLA ALLPILDDLD       180
     RAREHGDLVG PFGSVAEQLT TALGKFGLTP FGAEGDPFDP TQHEAVTHQT SAEVTEPTCV       240
     QVMRRGYLVG ERLLRPALVG VAEPE                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page