(data stored in ACNUC7421 zone)

EMBL: CP000667.PE115

CP000667.PE115       Location/Qualifiers
FT   CDS             124781..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0115"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52600"
FT                   /db_xref="GOA:A4X150"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X150"
FT                   /protein_id="ABP52600.1"
FT                   /translation="MSSKDWIEKDFYAALGVGKAASADEIKKAYRQLARESHPDRNPGD
FT                   AKAEERFKAASEAYTVLGDDAKRREYDEMRSLFGSGAFRRNARGAGQSGGAPFDVGDLF
FT                   GGAAGGDRRFSGAGFQDLFGSIFPGGGGTASRGPARGRDVETEVALDFGDAIRGVTLPL
FT                   TLRTPGVCDTCHGDGAKPGTQPRACPTCRGAGVTTRNQGSFSFSEPCSDCQGVGTVVDE
FT                   KCPECQGTGGVTKNRTLNVRFPAGVADGQRIRLAGRGEPGARGGPAGDLFIQVKVSPDD
FT                   LFGRAGDDLTLTVPITFAEAVLGTDLRVPTFDGAVTLRVPPGTPSGRVLRARGKGVVRT
FT                   AGRAGDLLVTLEVTVPAKLSEEARAALETFVAQTPPAAREHLDARVRRGS"
     MSSKDWIEKD FYAALGVGKA ASADEIKKAY RQLARESHPD RNPGDAKAEE RFKAASEAYT        60
     VLGDDAKRRE YDEMRSLFGS GAFRRNARGA GQSGGAPFDV GDLFGGAAGG DRRFSGAGFQ       120
     DLFGSIFPGG GGTASRGPAR GRDVETEVAL DFGDAIRGVT LPLTLRTPGV CDTCHGDGAK       180
     PGTQPRACPT CRGAGVTTRN QGSFSFSEPC SDCQGVGTVV DEKCPECQGT GGVTKNRTLN       240
     VRFPAGVADG QRIRLAGRGE PGARGGPAGD LFIQVKVSPD DLFGRAGDDL TLTVPITFAE       300
     AVLGTDLRVP TFDGAVTLRV PPGTPSGRVL RARGKGVVRT AGRAGDLLVT LEVTVPAKLS       360
     EEARAALETF VAQTPPAARE HLDARVRRGS                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page