(data stored in ACNUC7421 zone)

EMBL: CP000667.PE116

CP000667.PE116       Location/Qualifiers
FT   CDS             125997..126437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0116"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52601"
FT                   /db_xref="GOA:A4X151"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4X151"
FT                   /protein_id="ABP52601.1"
FT                   /translation="MADNFVGADDPAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQP
FT                   GRATGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEQAEQRVARLEVEL
FT                   EAAYRRIAELEAVARFPGSDLMPASRTSTALVVWRPRRNPER"
     MADNFVGADD PAYEAKVLMI SVAARMAGMH PQTLRQYDRL GLVQPGRATG GGRRYSVRDV        60
     VLLREVQRLS QDDGINLAGV KRIIGLERLL EQAEQRVARL EVELEAAYRR IAELEAVARF       120
     PGSDLMPASR TSTALVVWRP RRNPER                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page