(data stored in ACNUC7421 zone)

EMBL: CP000667.PE117

CP000667.PE117       Location/Qualifiers
FT   CDS             126540..126734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52602"
FT                   /db_xref="UniProtKB/TrEMBL:A4X152"
FT                   /protein_id="ABP52602.1"
FT                   /translation="MAESAKSLAQQAEDRLEQVAEAVRKRFDELTEGRFSDQIKDGRFA
FT                   DPGDSGADQGHPANQHQRR"
     MAESAKSLAQ QAEDRLEQVA EAVRKRFDEL TEGRFSDQIK DGRFADPGDS GADQGHPANQ        60
     HQRR                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page