(data stored in ACNUC7421 zone)

EMBL: CP000667.PE12

CP000667.PE12        Location/Qualifiers
FT   CDS             14462..14590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52497"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U7"
FT                   /protein_id="ABP52497.1"
FT                   /translation="MFKKLLILVGIVGVAAIVAKRVKETNDERALWHEATTAPDLR"
     MFKKLLILVG IVGVAAIVAK RVKETNDERA LWHEATTAPD LR                           42
//

If you have problems or comments...

PBIL Back to PBIL home page