(data stored in ACNUC7421 zone)

EMBL: CP000667.PE120

CP000667.PE120       Location/Qualifiers
FT   CDS             complement(128698..129288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0120"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52605"
FT                   /db_xref="GOA:A4X155"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X155"
FT                   /protein_id="ABP52605.1"
FT                   /translation="MSHPFGGISTALAPHPTRSSRPSARGSLVHVRVRVEQTALPGIGV
FT                   RHDLMTESGRRLGVVSHRNGRRDLVLYDPDDPDACQADIPLTDDEAEALADILGASLLL
FT                   GQLSGLREQAAGLLTEQVAIPAASAYVGRKLGDTKARTRTGASIVAVLRHGEVIVSPEP
FT                   SFRFAAGDVVVVVGTRQGLDGVTAILADGDPDG"
     MSHPFGGIST ALAPHPTRSS RPSARGSLVH VRVRVEQTAL PGIGVRHDLM TESGRRLGVV        60
     SHRNGRRDLV LYDPDDPDAC QADIPLTDDE AEALADILGA SLLLGQLSGL REQAAGLLTE       120
     QVAIPAASAY VGRKLGDTKA RTRTGASIVA VLRHGEVIVS PEPSFRFAAG DVVVVVGTRQ       180
     GLDGVTAILA DGDPDG                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page