(data stored in ACNUC7421 zone)

EMBL: CP000667.PE123

CP000667.PE123       Location/Qualifiers
FT   CDS             133124..133729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52608"
FT                   /db_xref="GOA:A4X158"
FT                   /db_xref="UniProtKB/TrEMBL:A4X158"
FT                   /protein_id="ABP52608.1"
FT                   /translation="MSYPEPARRPAAVTAAVVLLALMAVVAVAYAVAGLFVLFGTVDAF
FT                   RLAAAGSAASSDEVDAMVLLVSVWTVAGVVASLLAGVLLAALAGVVRTGRSGARVATWV
FT                   VAGLGVLAGCCGLTVLSGMRVFPMRLGDEDRSTVELLAQLSEAYPDWWIPLGAGLSVGQ
FT                   VLGYFVVALLLALPTAATWFRQPRPSLHVPYPPPHPPR"
     MSYPEPARRP AAVTAAVVLL ALMAVVAVAY AVAGLFVLFG TVDAFRLAAA GSAASSDEVD        60
     AMVLLVSVWT VAGVVASLLA GVLLAALAGV VRTGRSGARV ATWVVAGLGV LAGCCGLTVL       120
     SGMRVFPMRL GDEDRSTVEL LAQLSEAYPD WWIPLGAGLS VGQVLGYFVV ALLLALPTAA       180
     TWFRQPRPSL HVPYPPPHPP R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page