(data stored in ACNUC7421 zone)

EMBL: CP000667.PE132

CP000667.PE132       Location/Qualifiers
FT   CDS             complement(140810..142411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0132"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52617"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X167"
FT                   /protein_id="ABP52617.1"
FT                   /translation="MVDENADRSYASGQQPASERDIEPLWPAAEADSASWSPASDDQGQ
FT                   PPTPPGPTPVPAAWASAPSDAARAWAPRPDSDLRGAVADVPTPHAPSVVPTPSVNLDQP
FT                   FSLDPTGPAPGTSTGGRPTGETSAGSGPVDDRAAWEGRGGTTTESPWVAPPQRPAPEDT
FT                   VSDPGSTGGDRRAGRAALPTPYPTIAGPPPPGPPPAGPPPGPYPPPAHGSAVPPVAGWT
FT                   PTAQPPPTAEDFARRRQLRPSDPMATMGVRAMANRMGLRLPPGRHEQEMRRDIEMVRRN
FT                   FGGLRQVTVVNPKGGAGKTVAILLLAMTFGQKRGGYVLAWDNNETQGTLGMRAQQDFHA
FT                   RTVRDLLRDLNQFHGSHGRVGDLSQYVRAQGEGMFDVLASDESATGGGMLTAAAFAEIR
FT                   EVVSRFYKLIFVDTGNNVRAQNWQAAIDATDQLVVTMSARNDSAETAARMLDHLEQSGR
FT                   QRLVRQAVTVVSMPPSRKEIDLPAIQAHFAARTRAVLLAPYERLVDSGEPLRYGALSSA
FT                   ARDAWLKIAAAVAEGL"
     MVDENADRSY ASGQQPASER DIEPLWPAAE ADSASWSPAS DDQGQPPTPP GPTPVPAAWA        60
     SAPSDAARAW APRPDSDLRG AVADVPTPHA PSVVPTPSVN LDQPFSLDPT GPAPGTSTGG       120
     RPTGETSAGS GPVDDRAAWE GRGGTTTESP WVAPPQRPAP EDTVSDPGST GGDRRAGRAA       180
     LPTPYPTIAG PPPPGPPPAG PPPGPYPPPA HGSAVPPVAG WTPTAQPPPT AEDFARRRQL       240
     RPSDPMATMG VRAMANRMGL RLPPGRHEQE MRRDIEMVRR NFGGLRQVTV VNPKGGAGKT       300
     VAILLLAMTF GQKRGGYVLA WDNNETQGTL GMRAQQDFHA RTVRDLLRDL NQFHGSHGRV       360
     GDLSQYVRAQ GEGMFDVLAS DESATGGGML TAAAFAEIRE VVSRFYKLIF VDTGNNVRAQ       420
     NWQAAIDATD QLVVTMSARN DSAETAARML DHLEQSGRQR LVRQAVTVVS MPPSRKEIDL       480
     PAIQAHFAAR TRAVLLAPYE RLVDSGEPLR YGALSSAARD AWLKIAAAVA EGL              533
//

If you have problems or comments...

PBIL Back to PBIL home page