(data stored in ACNUC7421 zone)

EMBL: CP000667.PE136

CP000667.PE136       Location/Qualifiers
FT   CDS             complement(147749..148963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0136"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52621"
FT                   /db_xref="GOA:A4X171"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X171"
FT                   /protein_id="ABP52621.1"
FT                   /translation="MAEFSLDLTEEQRDLRDWVHGFASEVVRPAAAEWDAREETPWPII
FT                   QEAAKVGLYGFEFLATCWGDPSGLSLPVACEELFWGDSGIGLSIFGTGLAVAAIYGTGT
FT                   PEQLMEWVPQCFGDLDSPAVAAFCTSEPEAGSDVGAMRTRAVYDEAADEWVLSGQKSYA
FT                   TNGGIAGVHVVTASVDPELGSRGQAAFVVPPGTPGLAATRKLRKLGLRASHTADVFLDD
FT                   VRVPGRCLLGGKDALDERLARARSGKRAASQAAMRTFELSRPTVGAQALGVARAAYEYA
FT                   LDYAKERVQFGRPIIENQAVAFALADMKMEIDAARLLVWRASWMGRNNRAFTAGEGSMS
FT                   KLKASEVAVSATEKAVQLLGGAGFLRDHPVERWYRDAKIYTIFEGTSEIQRLVVARAIS
FT                   GVQIR"
     MAEFSLDLTE EQRDLRDWVH GFASEVVRPA AAEWDAREET PWPIIQEAAK VGLYGFEFLA        60
     TCWGDPSGLS LPVACEELFW GDSGIGLSIF GTGLAVAAIY GTGTPEQLME WVPQCFGDLD       120
     SPAVAAFCTS EPEAGSDVGA MRTRAVYDEA ADEWVLSGQK SYATNGGIAG VHVVTASVDP       180
     ELGSRGQAAF VVPPGTPGLA ATRKLRKLGL RASHTADVFL DDVRVPGRCL LGGKDALDER       240
     LARARSGKRA ASQAAMRTFE LSRPTVGAQA LGVARAAYEY ALDYAKERVQ FGRPIIENQA       300
     VAFALADMKM EIDAARLLVW RASWMGRNNR AFTAGEGSMS KLKASEVAVS ATEKAVQLLG       360
     GAGFLRDHPV ERWYRDAKIY TIFEGTSEIQ RLVVARAISG VQIR                        404
//

If you have problems or comments...

PBIL Back to PBIL home page