(data stored in ACNUC7421 zone)

EMBL: CP000667.PE148

CP000667.PE148       Location/Qualifiers
FT   CDS             complement(160272..160838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0148"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52633"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A4X183"
FT                   /protein_id="ABP52633.1"
FT                   /translation="MAGHVPTVRAALFFTIRSGEQGPRSAPASADSIGTVLVVTTDQLP
FT                   GYEVRQILGEVVSSMARTRNPYREGVKNLRGGAYDPMAPDNLTRWRADSVARLGEEARR
FT                   LGANAVIGMRFDSRDCGEMWMEICAYGTAVIVVPRVPDVMPPDQPLVAAETANEPRIAP
FT                   EPSGIGEPATAPDLRSAAETPTPEV"
     MAGHVPTVRA ALFFTIRSGE QGPRSAPASA DSIGTVLVVT TDQLPGYEVR QILGEVVSSM        60
     ARTRNPYREG VKNLRGGAYD PMAPDNLTRW RADSVARLGE EARRLGANAV IGMRFDSRDC       120
     GEMWMEICAY GTAVIVVPRV PDVMPPDQPL VAAETANEPR IAPEPSGIGE PATAPDLRSA       180
     AETPTPEV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page