(data stored in ACNUC7421 zone)

EMBL: CP000667.PE155

CP000667.PE155       Location/Qualifiers
FT   CDS             169887..171041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0155"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52640"
FT                   /db_xref="GOA:A4X190"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4X190"
FT                   /protein_id="ABP52640.1"
FT                   /translation="MTHVSERSGAGSSQTGAGGDRQPWTTATGRPVRKRSASYLDAGVS
FT                   IEAGDRAVELLKSKVKQTRRPEVMGDLGGFAGLFRLDTKKYKSPILASSTDGVGTKLVI
FT                   AQQLDIHDTVGIDLVAMVVDDLVACGAEPLFLLDYIATGEVVPDRVAEIGAGIADGCRY
FT                   AGCALLGGETAEHPGVLRPDEYDISATGVGVVEESGILSSERVEVGDVVIAMRASGLHS
FT                   NGFSLVRHVLLGAGRMRLDVVIEDFGRQRTLGEELLTPTKIYAQDCLKLIAEAEVRVFA
FT                   HVTGGGIPGNLVRVLPEHVDAVVNRATWKPQPIFDLVQSKGRIEAPEMEATFNMGVGMF
FT                   AIVSAEDADRALATLTGRGVDAWQAGEIIEGTGNVQLVGQHTRG"
     MTHVSERSGA GSSQTGAGGD RQPWTTATGR PVRKRSASYL DAGVSIEAGD RAVELLKSKV        60
     KQTRRPEVMG DLGGFAGLFR LDTKKYKSPI LASSTDGVGT KLVIAQQLDI HDTVGIDLVA       120
     MVVDDLVACG AEPLFLLDYI ATGEVVPDRV AEIGAGIADG CRYAGCALLG GETAEHPGVL       180
     RPDEYDISAT GVGVVEESGI LSSERVEVGD VVIAMRASGL HSNGFSLVRH VLLGAGRMRL       240
     DVVIEDFGRQ RTLGEELLTP TKIYAQDCLK LIAEAEVRVF AHVTGGGIPG NLVRVLPEHV       300
     DAVVNRATWK PQPIFDLVQS KGRIEAPEME ATFNMGVGMF AIVSAEDADR ALATLTGRGV       360
     DAWQAGEIIE GTGNVQLVGQ HTRG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page