(data stored in ACNUC7421 zone)

EMBL: CP000667.PE158

CP000667.PE158       Location/Qualifiers
FT   CDS             complement(172731..172946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52643"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:A4X193"
FT                   /protein_id="ABP52643.1"
FT                   /translation="MGRGRAKAKQTKVARELKYHSPNTDLAALQRELGGSHKSDHDFDD
FT                   DYKEYVDDDDEDHVDDDPDNRARPNR"
     MGRGRAKAKQ TKVARELKYH SPNTDLAALQ RELGGSHKSD HDFDDDYKEY VDDDDEDHVD        60
     DDPDNRARPN R                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page