(data stored in ACNUC7421 zone)

EMBL: CP000667.PE160

CP000667.PE160       Location/Qualifiers
FT   CDS             174389..175378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52645"
FT                   /db_xref="UniProtKB/TrEMBL:A4X195"
FT                   /protein_id="ABP52645.1"
FT                   /translation="MPLSLVSADIVSVVTDVCVRTAGPAARRLPGVHAKLCHQGFASDS
FT                   WEDRAVPSLFAAYLRVYEPLTAFDRSRQAYWRRYVEQGRAVAPVEGPGRQLTSVIEALG
FT                   AGWTRLPDLPDEAYVLEADDTLLVCPWNLRIRVAEAALNARDGVPPVLADAFVPPVLAG
FT                   KAKAVVDDWRSGARVLEHGVPRVHEQIATWGVPLRWFVLFEPAERHQVTEPGRRALRYR
FT                   TEISKARRRSSRALAVLRKSVGAAPITEAVEEAARWLEEFHPRSVVELDYGGLVSLLSD
FT                   ETLAADDSPELVAAGLAGLSRGEAEEASSAYDKLVARWRAVQLLERCN"
     MPLSLVSADI VSVVTDVCVR TAGPAARRLP GVHAKLCHQG FASDSWEDRA VPSLFAAYLR        60
     VYEPLTAFDR SRQAYWRRYV EQGRAVAPVE GPGRQLTSVI EALGAGWTRL PDLPDEAYVL       120
     EADDTLLVCP WNLRIRVAEA ALNARDGVPP VLADAFVPPV LAGKAKAVVD DWRSGARVLE       180
     HGVPRVHEQI ATWGVPLRWF VLFEPAERHQ VTEPGRRALR YRTEISKARR RSSRALAVLR       240
     KSVGAAPITE AVEEAARWLE EFHPRSVVEL DYGGLVSLLS DETLAADDSP ELVAAGLAGL       300
     SRGEAEEASS AYDKLVARWR AVQLLERCN                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page