(data stored in ACNUC7421 zone)

EMBL: CP000667.PE162

CP000667.PE162       Location/Qualifiers
FT   CDS             complement(175963..176445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52647"
FT                   /db_xref="GOA:A4X197"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:A4X197"
FT                   /protein_id="ABP52647.1"
FT                   /translation="MDTAGAVPRPGLRYTARRRAHCPVSRPRSRILGGVTTLDRLATEK
FT                   YILLTTFRKDGRAVPTPVWAVRDGDALAVWTVTGSGKVKRIRRSGDVTVAPCDVRGRPH
FT                   GPAVPGHAALADSAGTRRVRGLIKEKYRVLGRLTLLGSRLRRGEQGTVGIRVTLKG"
     MDTAGAVPRP GLRYTARRRA HCPVSRPRSR ILGGVTTLDR LATEKYILLT TFRKDGRAVP        60
     TPVWAVRDGD ALAVWTVTGS GKVKRIRRSG DVTVAPCDVR GRPHGPAVPG HAALADSAGT       120
     RRVRGLIKEK YRVLGRLTLL GSRLRRGEQG TVGIRVTLKG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page