(data stored in ACNUC7421 zone)

EMBL: CP000667.PE169

CP000667.PE169       Location/Qualifiers
FT   CDS             182587..183477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52654"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A4"
FT                   /protein_id="ABP52654.1"
FT                   /translation="MGPEFAPGVKGVKALTDESGKANFSGIYNQETPCAYYANLRRLKY
FT                   EIPQHGATVFNQLIDAQPWGDGYRPTVLDVCCSYGIVGVLTKTDLELDDVYTYYQGAGD
FT                   DGRTVDQVRRAENEFLGQRARPAAPHVIGLDVAENAARHGVAVGALDDAFVENLEATTP
FT                   SSELAKKMSEVDLITTTGGIGYVTERTFERLLTCTEAPPWVAAFCLRTYDYEPISEVLA
FT                   QYGLVTEKADQAVRQRRFIDDTEREWAMAELAARGVDPADMESEGYLYADFYLSRPQED
FT                   ATGKPLADLVTIPAN"
     MGPEFAPGVK GVKALTDESG KANFSGIYNQ ETPCAYYANL RRLKYEIPQH GATVFNQLID        60
     AQPWGDGYRP TVLDVCCSYG IVGVLTKTDL ELDDVYTYYQ GAGDDGRTVD QVRRAENEFL       120
     GQRARPAAPH VIGLDVAENA ARHGVAVGAL DDAFVENLEA TTPSSELAKK MSEVDLITTT       180
     GGIGYVTERT FERLLTCTEA PPWVAAFCLR TYDYEPISEV LAQYGLVTEK ADQAVRQRRF       240
     IDDTEREWAM AELAARGVDP ADMESEGYLY ADFYLSRPQE DATGKPLADL VTIPAN           296
//

If you have problems or comments...

PBIL Back to PBIL home page