(data stored in ACNUC7421 zone)

EMBL: CP000667.PE171

CP000667.PE171       Location/Qualifiers
FT   CDS             185047..185970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0171"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52656"
FT                   /db_xref="GOA:A4X1A6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A6"
FT                   /protein_id="ABP52656.1"
FT                   /translation="MGAGHDHGQQAARAGEKHRGRLWAAFGLLLTFMVVEAVAAVMTGS
FT                   LALLSDAGHMFTDVLGMGMALAAITAASKASRAGQRTFGLYRMEVLAALANAVLLFGVA
FT                   SYVVVEAVRRFGQPPEVLARPMVVVAVAGLLANVVAFFLLRAGSRESLNVRGAYLEVLG
FT                   DLFTSVGVIIAAVVITLTDWWYADPLIAVVVGLFILPRAYQLGRAALRVLVQAAPVHLD
FT                   ISVVRAAMLGVDGVADVHDLHVWTLTSGMEVASAHLALERDADFAAVLATSQRLLRDRF
FT                   AVEHATLQAEPAEPANADDVCHGSGW"
     MGAGHDHGQQ AARAGEKHRG RLWAAFGLLL TFMVVEAVAA VMTGSLALLS DAGHMFTDVL        60
     GMGMALAAIT AASKASRAGQ RTFGLYRMEV LAALANAVLL FGVASYVVVE AVRRFGQPPE       120
     VLARPMVVVA VAGLLANVVA FFLLRAGSRE SLNVRGAYLE VLGDLFTSVG VIIAAVVITL       180
     TDWWYADPLI AVVVGLFILP RAYQLGRAAL RVLVQAAPVH LDISVVRAAM LGVDGVADVH       240
     DLHVWTLTSG MEVASAHLAL ERDADFAAVL ATSQRLLRDR FAVEHATLQA EPAEPANADD       300
     VCHGSGW                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page