(data stored in ACNUC7421 zone)

EMBL: CP000667.PE179

CP000667.PE179       Location/Qualifiers
FT   CDS             198296..198967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0179"
FT                   /product="respiratory nitrate reductase chaperone NarJ"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52664"
FT                   /db_xref="GOA:A4X1B4"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B4"
FT                   /protein_id="ABP52664.1"
FT                   /translation="MTAATDRARIFELVSLLLTYPDDELLGAGAELRGAAARIGAQEAR
FT                   ERIDGFLDWLLDNTPIDVQQHFVQTFDLRRRSGLYLTYYLHGDTRKRGMALLVLKQRYR
FT                   AHGLRLADGELPDLLPVVLEYAAMVGPGEGEAPLRQHRQGIELLRAALTDCGTPYRLLL
FT                   DVICAVLPALTDADRAAIAALAVDGPPVETVGLESLGEGPDLHAAALAPYSACSPSEAS
FT                   R"
     MTAATDRARI FELVSLLLTY PDDELLGAGA ELRGAAARIG AQEARERIDG FLDWLLDNTP        60
     IDVQQHFVQT FDLRRRSGLY LTYYLHGDTR KRGMALLVLK QRYRAHGLRL ADGELPDLLP       120
     VVLEYAAMVG PGEGEAPLRQ HRQGIELLRA ALTDCGTPYR LLLDVICAVL PALTDADRAA       180
     IAALAVDGPP VETVGLESLG EGPDLHAAAL APYSACSPSE ASR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page