(data stored in ACNUC7421 zone)

EMBL: CP000667.PE180

CP000667.PE180       Location/Qualifiers
FT   CDS             198964..199707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0180"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52665"
FT                   /db_xref="GOA:A4X1B5"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B5"
FT                   /protein_id="ABP52665.1"
FT                   /translation="MTNLVWIVLPYLCLAVFVAGHVWRWRHDQFGWTTHTSQVLENRIL
FT                   RLGSPLFHLGALGVVAGHAMGLVVPASVTEKLGLSEHAYHLIAVWGGTVTGLMLTVGLV
FT                   LLIIRRMVNGRVRRVTTRMDKVLYAALAGMVALGMVATVGVNLLGGGYDYRETIAVWFR
FT                   GIFWFQPDPALMSGAPLVYQLHAIGGFLFLALWPFTRLVHVWSAPLAYLWRPYVVYRAR
FT                   RGPAPSPTASPNQVRDAAREPSARR"
     MTNLVWIVLP YLCLAVFVAG HVWRWRHDQF GWTTHTSQVL ENRILRLGSP LFHLGALGVV        60
     AGHAMGLVVP ASVTEKLGLS EHAYHLIAVW GGTVTGLMLT VGLVLLIIRR MVNGRVRRVT       120
     TRMDKVLYAA LAGMVALGMV ATVGVNLLGG GYDYRETIAV WFRGIFWFQP DPALMSGAPL       180
     VYQLHAIGGF LFLALWPFTR LVHVWSAPLA YLWRPYVVYR ARRGPAPSPT ASPNQVRDAA       240
     REPSARR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page