(data stored in ACNUC7421 zone)

EMBL: CP000667.PE185

CP000667.PE185       Location/Qualifiers
FT   CDS             209436..210458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0185"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52670"
FT                   /db_xref="GOA:A4X1C0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C0"
FT                   /protein_id="ABP52670.1"
FT                   /translation="MRATVLHGPGDIRLEQRPDPTITAPTDAVVRIAASCVCGSDLWPY
FT                   RGIESISQPIPMGHEYVGVVDAVGSDVRKIKPGQFVVGSFFASDNTCEICRAGYQSSCL
FT                   QREYMGNLGAQAELLRVPLADGTLVATPEVPDEDLIPSLLMASDVLGTGWFGAASADIR
FT                   PGKSVVVVGDGAVGLFAVLAARRFGAERIIVMSRHADRQKLALAHGATEVVTERGDDGV
FT                   ARIRDLTDGLGVHSAVEAVGTQESMLQAIRSTRPSGHVGFVGAPHGVTLSGHELFYSHV
FT                   HLHGGPAPVRRFLPELIDLIFSRSIDPSKIVDLTLPLDQVAEAYSAMHERRAVKAVLLP
FT                   "
     MRATVLHGPG DIRLEQRPDP TITAPTDAVV RIAASCVCGS DLWPYRGIES ISQPIPMGHE        60
     YVGVVDAVGS DVRKIKPGQF VVGSFFASDN TCEICRAGYQ SSCLQREYMG NLGAQAELLR       120
     VPLADGTLVA TPEVPDEDLI PSLLMASDVL GTGWFGAASA DIRPGKSVVV VGDGAVGLFA       180
     VLAARRFGAE RIIVMSRHAD RQKLALAHGA TEVVTERGDD GVARIRDLTD GLGVHSAVEA       240
     VGTQESMLQA IRSTRPSGHV GFVGAPHGVT LSGHELFYSH VHLHGGPAPV RRFLPELIDL       300
     IFSRSIDPSK IVDLTLPLDQ VAEAYSAMHE RRAVKAVLLP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page