(data stored in ACNUC7421 zone)

EMBL: CP000667.PE186

CP000667.PE186       Location/Qualifiers
FT   CDS             complement(210543..212369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0186"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52671"
FT                   /db_xref="GOA:A4X1C1"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C1"
FT                   /protein_id="ABP52671.1"
FT                   /translation="MTVTLYGDKVPPADDRPTVQVTAVQWPVEEAEKPTKRGGKWSFPP
FT                   GGKWSRRTWLLAAGVTTAVLASAVGIGAYAYAGDVPRGTTVLGTELSGYSQAAAVEELR
FT                   AAVERQAAELNAPLPVVVGDNTAELVPAEVGLRVDVEATVAAAMQVEAHVFERLVGSRT
FT                   VPPVVTVDVDQLDAALKKVLGDDGRTMTMPAITWSGLTPKATHPKPSLELDPERSAQAV
FT                   REGWLSGEPVTVPLAQIHPVTTAEEVDQMVAELARPAVAAPVTLTTDQGSMSIPPAAIA
FT                   KSLVFTADDAGALSAKVDVEKLRTALGDDLAKVEVTPKNARMTLTDGKPKIIESRDGKK
FT                   LDTSSLGEALLAVLPQSDDRRVTGTLTTAKPELTTEKLAGLGIREQVSTFTTQFSGGLS
FT                   SPRSQNIITAAKDVDNTLVLPGETFSLNGHTGDRNYAKGYKDAPVILNGKLVPGVGGGV
FT                   SQFTTTLFNATYYAGLEDVEHKPHSYYFSRYPAVIESTIFYPELDFKFRNNTEYGLLID
FT                   TSYTSNKITVSIWSTKIWDKVKTEYGPRKNITKPKTVHLEPGPNCIAASGSDGFSQSAY
FT                   RVFYKDGKEVKREKFSWRYAAEPRFICGPKPS"
     MTVTLYGDKV PPADDRPTVQ VTAVQWPVEE AEKPTKRGGK WSFPPGGKWS RRTWLLAAGV        60
     TTAVLASAVG IGAYAYAGDV PRGTTVLGTE LSGYSQAAAV EELRAAVERQ AAELNAPLPV       120
     VVGDNTAELV PAEVGLRVDV EATVAAAMQV EAHVFERLVG SRTVPPVVTV DVDQLDAALK       180
     KVLGDDGRTM TMPAITWSGL TPKATHPKPS LELDPERSAQ AVREGWLSGE PVTVPLAQIH       240
     PVTTAEEVDQ MVAELARPAV AAPVTLTTDQ GSMSIPPAAI AKSLVFTADD AGALSAKVDV       300
     EKLRTALGDD LAKVEVTPKN ARMTLTDGKP KIIESRDGKK LDTSSLGEAL LAVLPQSDDR       360
     RVTGTLTTAK PELTTEKLAG LGIREQVSTF TTQFSGGLSS PRSQNIITAA KDVDNTLVLP       420
     GETFSLNGHT GDRNYAKGYK DAPVILNGKL VPGVGGGVSQ FTTTLFNATY YAGLEDVEHK       480
     PHSYYFSRYP AVIESTIFYP ELDFKFRNNT EYGLLIDTSY TSNKITVSIW STKIWDKVKT       540
     EYGPRKNITK PKTVHLEPGP NCIAASGSDG FSQSAYRVFY KDGKEVKREK FSWRYAAEPR       600
     FICGPKPS                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page