(data stored in ACNUC7421 zone)

EMBL: CP000667.PE195

CP000667.PE195       Location/Qualifiers
FT   CDS             225598..226650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52680"
FT                   /db_xref="GOA:A4X1D0"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D0"
FT                   /protein_id="ABP52680.1"
FT                   /translation="MKLRVSAALFGLGVLLLVFAVGLPLYVAPAISKLPYDLKPTTLVA
FT                   EANNARFLQITADSETVTVEVPRATLRSTIEVLPQPGDTKDRLPDQLKGDAVIWDVYQT
FT                   VVRSDTQDPITMYSTQLALYRVSAEAAPWDDQWLKQDDSDETPRGNVSYSGLIYKFPFG
FT                   AEKKDYPVFDRDLKEAIPATFVGTETVEGVEVYRYEQRIENRVLDTPEESLQVLLSTFA
FT                   PGSTTGEIVYSNTRTYWVDPVTGAWVDVREQQRKELRPDVGSTTVLLDADFNYTDDTVN
FT                   NSVESVKTNRLKIGLARLWGPIAAGVLGLIALAVGLRLFLQTGGAAGRHAAAAPAAGGP
FT                   ATGKEDQDSS"
     MKLRVSAALF GLGVLLLVFA VGLPLYVAPA ISKLPYDLKP TTLVAEANNA RFLQITADSE        60
     TVTVEVPRAT LRSTIEVLPQ PGDTKDRLPD QLKGDAVIWD VYQTVVRSDT QDPITMYSTQ       120
     LALYRVSAEA APWDDQWLKQ DDSDETPRGN VSYSGLIYKF PFGAEKKDYP VFDRDLKEAI       180
     PATFVGTETV EGVEVYRYEQ RIENRVLDTP EESLQVLLST FAPGSTTGEI VYSNTRTYWV       240
     DPVTGAWVDV REQQRKELRP DVGSTTVLLD ADFNYTDDTV NNSVESVKTN RLKIGLARLW       300
     GPIAAGVLGL IALAVGLRLF LQTGGAAGRH AAAAPAAGGP ATGKEDQDSS                  350
//

If you have problems or comments...

PBIL Back to PBIL home page