(data stored in ACNUC7421 zone)

EMBL: CP000667.PE196

CP000667.PE196       Location/Qualifiers
FT   CDS             complement(226809..228479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0196"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52681"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D1"
FT                   /protein_id="ABP52681.1"
FT                   /translation="MGRIDDIANRYVAEWAALSPTGATYVGITGHDDRLDDLSPDGYAA
FT                   RADLNRRVLADLDGVEPQSPAEQTAKDAMQERLSLELARYAAGEVGRGVNVITSGLHEL
FT                   RSVFDLMPTDGEEAQANIAARLGHFAEALGQYQTTLREAAAAGQSSARAQLLEVAKQCD
FT                   TWVDPDGDNFFHGLVERLGAGGALDAELRRGAATATAATAEFGRFLRTELAPQGRAKQA
FT                   AGREHYELASQYFLGARVDLDETYAWGFEELARLETEMRAVATRIVGPGATVDEAVAAL
FT                   DADGTRTIRGKEAFRDWMQELADKAISELHGTHFDIPEQVHQIECCLAPTSDGAIYYTG
FT                   PSEDFSRPGRMWWAVPQGIDDFSTWREVTTVYHEGVPGHHLQVAQTVLRAETLNRWQRL
FT                   LCWVSGHGEGWALYAERLMEELGYLEDPGDRLGMLDGQALRAARVIVDIGMHLELEIPA
FT                   DNPFGFHPGERWTPELGWEFMRAHCRVSDEVLRFELNRYLGWPGQAPSYKVGERIWLQA
FT                   RADAKARRGAEFDLREFHRQALDLGSLGLDPLRRALARI"
     MGRIDDIANR YVAEWAALSP TGATYVGITG HDDRLDDLSP DGYAARADLN RRVLADLDGV        60
     EPQSPAEQTA KDAMQERLSL ELARYAAGEV GRGVNVITSG LHELRSVFDL MPTDGEEAQA       120
     NIAARLGHFA EALGQYQTTL REAAAAGQSS ARAQLLEVAK QCDTWVDPDG DNFFHGLVER       180
     LGAGGALDAE LRRGAATATA ATAEFGRFLR TELAPQGRAK QAAGREHYEL ASQYFLGARV       240
     DLDETYAWGF EELARLETEM RAVATRIVGP GATVDEAVAA LDADGTRTIR GKEAFRDWMQ       300
     ELADKAISEL HGTHFDIPEQ VHQIECCLAP TSDGAIYYTG PSEDFSRPGR MWWAVPQGID       360
     DFSTWREVTT VYHEGVPGHH LQVAQTVLRA ETLNRWQRLL CWVSGHGEGW ALYAERLMEE       420
     LGYLEDPGDR LGMLDGQALR AARVIVDIGM HLELEIPADN PFGFHPGERW TPELGWEFMR       480
     AHCRVSDEVL RFELNRYLGW PGQAPSYKVG ERIWLQARAD AKARRGAEFD LREFHRQALD       540
     LGSLGLDPLR RALARI                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page