(data stored in ACNUC7421 zone)

EMBL: CP000667.PE197

CP000667.PE197       Location/Qualifiers
FT   CDS             228612..229682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0197"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52682"
FT                   /db_xref="GOA:A4X1D2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D2"
FT                   /protein_id="ABP52682.1"
FT                   /translation="MPGYLALAAIWGSSFLFIKIGVRELHPLHLTLYRVGAGALTLLIL
FT                   LVALRDRLPREPRVWAHLVVTGGIGVALPFTLFGYGGERVESMLSGIWNATTPLVVLPM
FT                   AVLVFRTERITAARAVGLGLGFLGVLVVLGVWQGAGGSHFVGQLMCFGAAACYGVVIPY
FT                   QKKFVAGRSYSGLALSAAQLLMALALLTIVTPFVAGVPPMPTALSGSVLASMVALGALG
FT                   TGLAFLIHFRNIRVAGASTAATVTYVIPVFAVLAGALVLDERLTWHQPVGAVVVLLGVA
FT                   VTQGLIGPRRRPRAVALPTSAAGTSASAAGVPATADQELLPAHATSRSAGQALTTRSAG
FT                   TPQRAARSQPNRCQSS"
     MPGYLALAAI WGSSFLFIKI GVRELHPLHL TLYRVGAGAL TLLILLVALR DRLPREPRVW        60
     AHLVVTGGIG VALPFTLFGY GGERVESMLS GIWNATTPLV VLPMAVLVFR TERITAARAV       120
     GLGLGFLGVL VVLGVWQGAG GSHFVGQLMC FGAAACYGVV IPYQKKFVAG RSYSGLALSA       180
     AQLLMALALL TIVTPFVAGV PPMPTALSGS VLASMVALGA LGTGLAFLIH FRNIRVAGAS       240
     TAATVTYVIP VFAVLAGALV LDERLTWHQP VGAVVVLLGV AVTQGLIGPR RRPRAVALPT       300
     SAAGTSASAA GVPATADQEL LPAHATSRSA GQALTTRSAG TPQRAARSQP NRCQSS           356
//

If you have problems or comments...

PBIL Back to PBIL home page