(data stored in ACNUC7421 zone)

EMBL: CP000667.PE2

CP000667.PE2         Location/Qualifiers
FT   CDS             complement(2372..2842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52487"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T7"
FT                   /protein_id="ABP52487.1"
FT                   /translation="MEKPGENPGCHPQAGVTPSLSTVVHRLSTGYPRTSSPGLWIVSRV
FT                   STRVIPRTFNNLSTPGPPSVDNDTVFPKHPQGYPQGYPQPVDNERVDGLVFSTDATELW
FT                   TTSGTSWRRPDTRIRPTTPIRRPSFRSGGVWSTAYATAAPVQRCGVRLRCSA"
     MEKPGENPGC HPQAGVTPSL STVVHRLSTG YPRTSSPGLW IVSRVSTRVI PRTFNNLSTP        60
     GPPSVDNDTV FPKHPQGYPQ GYPQPVDNER VDGLVFSTDA TELWTTSGTS WRRPDTRIRP       120
     TTPIRRPSFR SGGVWSTAYA TAAPVQRCGV RLRCSA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page