(data stored in ACNUC7421 zone)

EMBL: CP000667.PE200

CP000667.PE200       Location/Qualifiers
FT   CDS             231462..231824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52685"
FT                   /db_xref="GOA:A4X1D5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D5"
FT                   /protein_id="ABP52685.1"
FT                   /translation="MTDPYDGARPRNPSGLFPAGAPARPTYREPHPIHGAAVVLGGGVA
FT                   TMWLLLFGLLGAGVRGYAWWTVLAGGLAWLVALLLVRHGDRGVATGVAIVVGGGWSIAA
FT                   AVVANRWMASGDWPLW"
     MTDPYDGARP RNPSGLFPAG APARPTYREP HPIHGAAVVL GGGVATMWLL LFGLLGAGVR        60
     GYAWWTVLAG GLAWLVALLL VRHGDRGVAT GVAIVVGGGW SIAAAVVANR WMASGDWPLW       120
//

If you have problems or comments...

PBIL Back to PBIL home page