(data stored in ACNUC7421 zone)

EMBL: CP000667.PE201

CP000667.PE201       Location/Qualifiers
FT   CDS             232139..232663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52686"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D6"
FT                   /protein_id="ABP52686.1"
FT                   /translation="MSYFAAAVVRDESGWTAAEVNLRGAVDVDGVADRLRDVDPGADLS
FT                   LLFVEAEDEYLVILRLDEGEDLRVFGSDSAYAEETQLGALLVGDLKASVTGLDETEEPR
FT                   AAGGDPESEQPAADPEADPVGDADLLADLGVSGTKLVALCGHEGMLPADVTTEACMVLG
FT                   CADEVEELREV"
     MSYFAAAVVR DESGWTAAEV NLRGAVDVDG VADRLRDVDP GADLSLLFVE AEDEYLVILR        60
     LDEGEDLRVF GSDSAYAEET QLGALLVGDL KASVTGLDET EEPRAAGGDP ESEQPAADPE       120
     ADPVGDADLL ADLGVSGTKL VALCGHEGML PADVTTEACM VLGCADEVEE LREV             174
//

If you have problems or comments...

PBIL Back to PBIL home page