(data stored in ACNUC7421 zone)

EMBL: CP000667.PE205

CP000667.PE205       Location/Qualifiers
FT   CDS             235592..235999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0205"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52690"
FT                   /db_xref="GOA:A4X1E0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E0"
FT                   /protein_id="ABP52690.1"
FT                   /translation="MADVRHPGSMIRLVLNVLWLIFGGGIVLAFGYFVAALICFVLVVT
FT                   IPFGVASLRLASYSLWPFGRTLVTKPGAGVASGLANVLWVLLAGWWLALSHLVAGVSLC
FT                   ITIIGIPFGIANFKLVPAAFWPLGQEVIEVR"
     MADVRHPGSM IRLVLNVLWL IFGGGIVLAF GYFVAALICF VLVVTIPFGV ASLRLASYSL        60
     WPFGRTLVTK PGAGVASGLA NVLWVLLAGW WLALSHLVAG VSLCITIIGI PFGIANFKLV       120
     PAAFWPLGQE VIEVR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page