(data stored in ACNUC7421 zone)

EMBL: CP000667.PE208

CP000667.PE208       Location/Qualifiers
FT   CDS             complement(237091..237960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52693"
FT                   /db_xref="GOA:A4X1E3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E3"
FT                   /protein_id="ABP52693.1"
FT                   /translation="MPFMVTSSVPLGRPFWTFWSAATLANVGDGIRLAAFPLLAASLTA
FT                   NPVGVAAVTAAQALPWLVTGLLAGSLADRRGARTLLAQADLARVVVLGVLVVAVATGWA
FT                   SLPLVLLASFLLGIGETVRDTAAQTALPGLVPERLLERANGKLVAGEIVGNEFVGPPVG
FT                   AALFVAGAALPFAANGASLALAVMLLLTLPISVAARPPQGTPKQASPGVVAGLRWLARH
FT                   RVLRTLALVTAAVAAADSAWFAILVLYAESRLSVGATGFGILLAAGALGGLLGSSVVDR
FT                   LVAGTGTA"
     MPFMVTSSVP LGRPFWTFWS AATLANVGDG IRLAAFPLLA ASLTANPVGV AAVTAAQALP        60
     WLVTGLLAGS LADRRGARTL LAQADLARVV VLGVLVVAVA TGWASLPLVL LASFLLGIGE       120
     TVRDTAAQTA LPGLVPERLL ERANGKLVAG EIVGNEFVGP PVGAALFVAG AALPFAANGA       180
     SLALAVMLLL TLPISVAARP PQGTPKQASP GVVAGLRWLA RHRVLRTLAL VTAAVAAADS       240
     AWFAILVLYA ESRLSVGATG FGILLAAGAL GGLLGSSVVD RLVAGTGTA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page