(data stored in ACNUC7421 zone)

EMBL: CP000667.PE213

CP000667.PE213       Location/Qualifiers
FT   CDS             242420..244846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0213"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52698"
FT                   /db_xref="GOA:A4X1E8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E8"
FT                   /protein_id="ABP52698.1"
FT                   /translation="MALALYRKYRPRTFAEVIGQEHVTEPLSQALRGGRLNHAYLFSGP
FT                   RGCGKTSSARILARSLNCEHGPTPEPCGTCASCRALATDGAGSIDVIEIDAASHGGVDD
FT                   ARELREKAFFAPAQSRFKIYVIDEAHMVSSAGFNALLKLVEEPPEYVKFIFATTEPEKV
FT                   LGTIKSRTHHYPFRLIPPKVLRPYLEQLCQAEGVQVEPAVFPLVVRAGGGSARDSLSVL
FT                   DQLIAGAGPEGVIYARAAALLGVTDSALIDEMCDALAAGDGAAAYATVDRIVGAGHDPR
FT                   RFAADLLERLRDLIILQRVPDAAPKGLVDGPDDQIERMTAQAQRLGPGTLSRCADIVHD
FT                   GLVEMRGATAPRLLLELICARLLLPRIDDSTGGLLQRLETLERRHTHAGADVPPAVPTP
FT                   ATGSSPAAAVPPAVPTPATGSSPAPAVPTPAAGAPPAPAVGSPPRPVGTAVSASMDGPA
FT                   VSDGPRRASPRPAVMPDPATPEPPRPGTTGQGPLDAAAVRRRWPEVVGLVGRKSKKAAA
FT                   WAREATVHEVDGQTLVLAFRYPFHAQALANEPDLLIESLHEELGERWQIRCEVAGERVG
FT                   GPAAGPRAAGPARPATAPARPDPAVAPAAPPRSSAGDGAVDGMAPRSAGSADEQEWPEP
FT                   ARPGGAAPPEPAAGTAEEWPATARPGGAGVDATAAAAAGPGGSTTGGGRASGAGVAPAA
FT                   SAVSRPPVTSGARASSAIAAARAAAAGGAQRSAASPRRTAEPDWAGEPPYDPDYDGVPR
FT                   GGAAPAVVHEGFDPGDEPLDEVIDERTARQSSEEQAVRLLREAFGAERIDEVKSR"
     MALALYRKYR PRTFAEVIGQ EHVTEPLSQA LRGGRLNHAY LFSGPRGCGK TSSARILARS        60
     LNCEHGPTPE PCGTCASCRA LATDGAGSID VIEIDAASHG GVDDARELRE KAFFAPAQSR       120
     FKIYVIDEAH MVSSAGFNAL LKLVEEPPEY VKFIFATTEP EKVLGTIKSR THHYPFRLIP       180
     PKVLRPYLEQ LCQAEGVQVE PAVFPLVVRA GGGSARDSLS VLDQLIAGAG PEGVIYARAA       240
     ALLGVTDSAL IDEMCDALAA GDGAAAYATV DRIVGAGHDP RRFAADLLER LRDLIILQRV       300
     PDAAPKGLVD GPDDQIERMT AQAQRLGPGT LSRCADIVHD GLVEMRGATA PRLLLELICA       360
     RLLLPRIDDS TGGLLQRLET LERRHTHAGA DVPPAVPTPA TGSSPAAAVP PAVPTPATGS       420
     SPAPAVPTPA AGAPPAPAVG SPPRPVGTAV SASMDGPAVS DGPRRASPRP AVMPDPATPE       480
     PPRPGTTGQG PLDAAAVRRR WPEVVGLVGR KSKKAAAWAR EATVHEVDGQ TLVLAFRYPF       540
     HAQALANEPD LLIESLHEEL GERWQIRCEV AGERVGGPAA GPRAAGPARP ATAPARPDPA       600
     VAPAAPPRSS AGDGAVDGMA PRSAGSADEQ EWPEPARPGG AAPPEPAAGT AEEWPATARP       660
     GGAGVDATAA AAAGPGGSTT GGGRASGAGV APAASAVSRP PVTSGARASS AIAAARAAAA       720
     GGAQRSAASP RRTAEPDWAG EPPYDPDYDG VPRGGAAPAV VHEGFDPGDE PLDEVIDERT       780
     ARQSSEEQAV RLLREAFGAE RIDEVKSR                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page