(data stored in ACNUC7421 zone)

EMBL: CP000667.PE216

CP000667.PE216       Location/Qualifiers
FT   CDS             246131..247792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0216"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52701"
FT                   /db_xref="GOA:A4X1F1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F1"
FT                   /protein_id="ABP52701.1"
FT                   /translation="MRASRPKVAVAAVAVAALAVAGCAESDREDSGGSNNDTLVFGVAG
FT                   DPKVLDPSFASDGESLRVARQVFETLVRPEEGGTKVSPGLAESWTPDEAGTTWTFKLRS
FT                   GVKFHDGTDFDAEAVCVNFNRWYNATGLMQSPDVTAYWQDVMGGFAQNEDEGLSESLFK
FT                   SCTAKDATTVDLTFTRVSSKIPAALMLPSFSIHSPTALEQYDASNVGGTATDVQYPEYA
FT                   TAHPTGTGPFKFKSWDIANKSLTIERNDDYWGEKAKLKTLIFRTIPDENARKQALSSGD
FT                   IQGYDLVGPADVEPLKGEGFNVLTRPAFNILYLGMNQQGNPKLADLKVRQAIAHAINRQ
FT                   ALVDSKLPPGAKVATNFFPDTVEGWNGDVTTYDYDVDKAKQLLAEADATDLTLRFHYPT
FT                   EVTRPYMPNPKDLFELVSADLQAAGITVEPIPLKWSPDYLNATTSGSEHDLHFLGWTGD
FT                   YGDAYNFIGTFFDRQKDEWGFDNPALFEQFQDADSTADMASRVEKYKGLNKTIMDFLPG
FT                   VPISHSPPAIVFGKDVTGIKASPLTDERFAKAEFTS"
     MRASRPKVAV AAVAVAALAV AGCAESDRED SGGSNNDTLV FGVAGDPKVL DPSFASDGES        60
     LRVARQVFET LVRPEEGGTK VSPGLAESWT PDEAGTTWTF KLRSGVKFHD GTDFDAEAVC       120
     VNFNRWYNAT GLMQSPDVTA YWQDVMGGFA QNEDEGLSES LFKSCTAKDA TTVDLTFTRV       180
     SSKIPAALML PSFSIHSPTA LEQYDASNVG GTATDVQYPE YATAHPTGTG PFKFKSWDIA       240
     NKSLTIERND DYWGEKAKLK TLIFRTIPDE NARKQALSSG DIQGYDLVGP ADVEPLKGEG       300
     FNVLTRPAFN ILYLGMNQQG NPKLADLKVR QAIAHAINRQ ALVDSKLPPG AKVATNFFPD       360
     TVEGWNGDVT TYDYDVDKAK QLLAEADATD LTLRFHYPTE VTRPYMPNPK DLFELVSADL       420
     QAAGITVEPI PLKWSPDYLN ATTSGSEHDL HFLGWTGDYG DAYNFIGTFF DRQKDEWGFD       480
     NPALFEQFQD ADSTADMASR VEKYKGLNKT IMDFLPGVPI SHSPPAIVFG KDVTGIKASP       540
     LTDERFAKAE FTS                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page