(data stored in ACNUC7421 zone)

EMBL: CP000667.PE218

CP000667.PE218       Location/Qualifiers
FT   CDS             248868..249830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0218"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52703"
FT                   /db_xref="GOA:A4X1F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F3"
FT                   /protein_id="ABP52703.1"
FT                   /translation="MTITGKKERLDRLAELVNRDDERGVSLWQEAFRRLRRNPAAIIGA
FT                   IILAIFVLVALIGPFFVPYEPKDTIGIREGLVKSGQGIIPGASAEHWFGYDHQGRDVFS
FT                   RMIVGARQTLLVGVVATLIGLAVGALIGGVAGAAAGLGGRWGRAVDNVLMRVIDMMLAL
FT                   PSLLLAVSIAALLGASLQTVMIAVGMVSVPVFARLLRVSMIAQANSDYVLAATSLGVRK
FT                   PKIALTHILPNSLAPVIVQATLTLATAIIEAAALSFLGLGNPDTAQPEWGVMLADAQPY
FT                   LGIRPALAIFPAVAIIITALGFTLLGEAMREALDPKLRK"
     MTITGKKERL DRLAELVNRD DERGVSLWQE AFRRLRRNPA AIIGAIILAI FVLVALIGPF        60
     FVPYEPKDTI GIREGLVKSG QGIIPGASAE HWFGYDHQGR DVFSRMIVGA RQTLLVGVVA       120
     TLIGLAVGAL IGGVAGAAAG LGGRWGRAVD NVLMRVIDMM LALPSLLLAV SIAALLGASL       180
     QTVMIAVGMV SVPVFARLLR VSMIAQANSD YVLAATSLGV RKPKIALTHI LPNSLAPVIV       240
     QATLTLATAI IEAAALSFLG LGNPDTAQPE WGVMLADAQP YLGIRPALAI FPAVAIIITA       300
     LGFTLLGEAM REALDPKLRK                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page