(data stored in ACNUC7421 zone)

EMBL: CP000667.PE220

CP000667.PE220       Location/Qualifiers
FT   CDS             250949..252064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0220"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52705"
FT                   /db_xref="GOA:A4X1F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F5"
FT                   /protein_id="ABP52705.1"
FT                   /translation="MTDNDVLVEVRDLKVHFPIKRGVLFDRTIGHVKAVDGVDLRIPRG
FT                   QTYGLVGESGCGKSTLGRALLQLTTPTGGEVVFDGVELTTLPPARLRAMRRRMQMIFQD
FT                   PMSSLDPRQNVESILTEGLQTHGIGGNRDERRAIIGEALDKVGLPRWALSRYPHEFSGG
FT                   QRQRIGIARAVVLGPELIVADEPVSALDVSIQAQVVNLLDELQESLGLTYLVIAHDLAV
FT                   VRHISDTVGVMYLGALVEEAPSDRLYTEPLHPYTRALMSAVPVPDPDVEDRRERILLAG
FT                   DLPSPANPPAGCRFHTRCPWAQPTRCTDERPVLRDIGGSRVACHWAERIASGELRPHNA
FT                   GARVARASSGGETPEPVSIPAPTGKADSADA"
     MTDNDVLVEV RDLKVHFPIK RGVLFDRTIG HVKAVDGVDL RIPRGQTYGL VGESGCGKST        60
     LGRALLQLTT PTGGEVVFDG VELTTLPPAR LRAMRRRMQM IFQDPMSSLD PRQNVESILT       120
     EGLQTHGIGG NRDERRAIIG EALDKVGLPR WALSRYPHEF SGGQRQRIGI ARAVVLGPEL       180
     IVADEPVSAL DVSIQAQVVN LLDELQESLG LTYLVIAHDL AVVRHISDTV GVMYLGALVE       240
     EAPSDRLYTE PLHPYTRALM SAVPVPDPDV EDRRERILLA GDLPSPANPP AGCRFHTRCP       300
     WAQPTRCTDE RPVLRDIGGS RVACHWAERI ASGELRPHNA GARVARASSG GETPEPVSIP       360
     APTGKADSAD A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page