(data stored in ACNUC7421 zone)

EMBL: CP000667.PE222

CP000667.PE222       Location/Qualifiers
FT   CDS             complement(252578..253327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52707"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F7"
FT                   /protein_id="ABP52707.1"
FT                   /translation="MPKSAPTRSRSGYETPKPPSQILCGAARNRQAKEVSLRTRSAPLL
FT                   ATALALGLAGCVPATTPDPTPTSAGGNAMEKLAELTVASAGSMKGYSRDRFPHWRGTGK
FT                   NCDVRDTVLARDGESIKLSGCNVVGGRWESVYDGLVLTDPSEVDVDHMVPLANAWRSGA
FT                   DGWTDTKRGDFANDTRLPHLFAVSRTANRSKGDQDPSQWRPANRSYWCRYAESWVTVKH
FT                   HWQLSVHTDEKTALADMLAGCTGASRP"
     MPKSAPTRSR SGYETPKPPS QILCGAARNR QAKEVSLRTR SAPLLATALA LGLAGCVPAT        60
     TPDPTPTSAG GNAMEKLAEL TVASAGSMKG YSRDRFPHWR GTGKNCDVRD TVLARDGESI       120
     KLSGCNVVGG RWESVYDGLV LTDPSEVDVD HMVPLANAWR SGADGWTDTK RGDFANDTRL       180
     PHLFAVSRTA NRSKGDQDPS QWRPANRSYW CRYAESWVTV KHHWQLSVHT DEKTALADML       240
     AGCTGASRP                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page