(data stored in ACNUC7421 zone)

EMBL: CP000667.PE228

CP000667.PE228       Location/Qualifiers
FT   CDS             complement(259989..261416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0228"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52713"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G3"
FT                   /protein_id="ABP52713.1"
FT                   /translation="MRVDHERIIRDGTARLSMASTVAEACQWTVTALAPSTPATISVLL
FT                   EVHDRLRCIAATGSWQVFSTVPPATGVVGRVHTTGHAAVITDLGADPNRLPVRPDATSE
FT                   VCVPVPGSTGRPVGVLDLLWSQPADLMAWRDTAERLAERLGARIVALGGPPAETRSEKL
FT                   LRHAAALAAAGTEQELRHAASTAARDVSTLSTAVLVLPGHHGPQLCAPTTVPDELEARV
FT                   RATLSAAGPEALARMVDLAHRYGAGYTLGETEQSATDDHAPLARAGVRTLVAVPVNSGG
FT                   DAGLLLVADARRLRPDPTTVNLLELLAGQAGSALDRLETVARLRERASSDPLTGLRHTG
FT                   PFGERIAAAAPGRTALLAIDVDGFKTVNDTYGHQAGDRLLVRLARALEGALRQGDELYR
FT                   TGGDEFVAVIEVNRPDEAVRVAERLTAAARRIGRTISVGVALPHPDEPADHALHRADQA
FT                   LYRVKREGRDGVRLAAA"
     MRVDHERIIR DGTARLSMAS TVAEACQWTV TALAPSTPAT ISVLLEVHDR LRCIAATGSW        60
     QVFSTVPPAT GVVGRVHTTG HAAVITDLGA DPNRLPVRPD ATSEVCVPVP GSTGRPVGVL       120
     DLLWSQPADL MAWRDTAERL AERLGARIVA LGGPPAETRS EKLLRHAAAL AAAGTEQELR       180
     HAASTAARDV STLSTAVLVL PGHHGPQLCA PTTVPDELEA RVRATLSAAG PEALARMVDL       240
     AHRYGAGYTL GETEQSATDD HAPLARAGVR TLVAVPVNSG GDAGLLLVAD ARRLRPDPTT       300
     VNLLELLAGQ AGSALDRLET VARLRERASS DPLTGLRHTG PFGERIAAAA PGRTALLAID       360
     VDGFKTVNDT YGHQAGDRLL VRLARALEGA LRQGDELYRT GGDEFVAVIE VNRPDEAVRV       420
     AERLTAAARR IGRTISVGVA LPHPDEPADH ALHRADQALY RVKREGRDGV RLAAA            475
//

If you have problems or comments...

PBIL Back to PBIL home page