(data stored in ACNUC7421 zone)

EMBL: CP000667.PE229

CP000667.PE229       Location/Qualifiers
FT   CDS             261690..263393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0229"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52714"
FT                   /db_xref="GOA:A4X1G4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G4"
FT                   /protein_id="ABP52714.1"
FT                   /translation="MSIPGMRRAAIGLTAFAVTAFGAVATAPNEADAGPKPVDVTLLAL
FT                   NDFHGHLEPPGGSSGTIEDQPAGGVEYLATHLAELRKASKKKNTVTVAAGDLIGASPLL
FT                   SAAFHDEPTIEALSQAGLDYASVGNHEFDEGSDELLRIQHGGCHPVDGCADGTPYQGAD
FT                   FQYLSANAFVDETGQPLLPPYAIHRVQGVKIGFIGMTLEGTPDIVSPDGVAGLTFADEA
FT                   QTANRYARELRRKGVETIVVLLHEGGNQAGAGGINDCVDFTGPVVDIVNRMDRSIDVVV
FT                   SGHTHQAYNCEVNNKLVTSASSYGRLITDIDLKIDRRTGDVLRATAQNLVVTRDVAEDP
FT                   DQTALIDHYQTVLGPVAGREVGETTEAITRTQETLFDTVRGESPLGNLIADAQHWATEG
FT                   DQNAVAAFMNPGGVRADLDAGPVTYEEAFTAQPFSNNLVTLDLTGEQLYCLLEQQFVTE
FT                   RVLYPSATVRYVVDPAGGTAPADDPCAGTRVVRGSLTFADVPVETDATYRVTVNNFLAG
FT                   GGDGFSVLTDGTNPATGQIDLDALVAYLTATSPVSAPATDRIRTTGESAR"
     MSIPGMRRAA IGLTAFAVTA FGAVATAPNE ADAGPKPVDV TLLALNDFHG HLEPPGGSSG        60
     TIEDQPAGGV EYLATHLAEL RKASKKKNTV TVAAGDLIGA SPLLSAAFHD EPTIEALSQA       120
     GLDYASVGNH EFDEGSDELL RIQHGGCHPV DGCADGTPYQ GADFQYLSAN AFVDETGQPL       180
     LPPYAIHRVQ GVKIGFIGMT LEGTPDIVSP DGVAGLTFAD EAQTANRYAR ELRRKGVETI       240
     VVLLHEGGNQ AGAGGINDCV DFTGPVVDIV NRMDRSIDVV VSGHTHQAYN CEVNNKLVTS       300
     ASSYGRLITD IDLKIDRRTG DVLRATAQNL VVTRDVAEDP DQTALIDHYQ TVLGPVAGRE       360
     VGETTEAITR TQETLFDTVR GESPLGNLIA DAQHWATEGD QNAVAAFMNP GGVRADLDAG       420
     PVTYEEAFTA QPFSNNLVTL DLTGEQLYCL LEQQFVTERV LYPSATVRYV VDPAGGTAPA       480
     DDPCAGTRVV RGSLTFADVP VETDATYRVT VNNFLAGGGD GFSVLTDGTN PATGQIDLDA       540
     LVAYLTATSP VSAPATDRIR TTGESAR                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page