(data stored in ACNUC7421 zone)

EMBL: CP000667.PE23

CP000667.PE23        Location/Qualifiers
FT   CDS             27489..28268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0023"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52508"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V8"
FT                   /protein_id="ABP52508.1"
FT                   /translation="MEGVVGWRSFVAVGDSFTEGLNDAYPDGGFRGWADLVATRLAVEA
FT                   GPEFRYANLAIRGRLFPRVVDEQVPAALAMQPDLISFAAGGNDMLRRSFDPDDLIARFN
FT                   EVVGRLRAGGADVVLFRFADVMARLPGQRLVAPRVQVLNQAVGDTAERHGAILVDLYED
FT                   DTYLNPMMWSTDRLHLSSAGHRRVAAQVLTALGVSCADEWLLVPERPLPKPWLAARTDD
FT                   LRWATHHLAPWLTRRLTGRSSGDTVTAKRPALTPLTD"
     MEGVVGWRSF VAVGDSFTEG LNDAYPDGGF RGWADLVATR LAVEAGPEFR YANLAIRGRL        60
     FPRVVDEQVP AALAMQPDLI SFAAGGNDML RRSFDPDDLI ARFNEVVGRL RAGGADVVLF       120
     RFADVMARLP GQRLVAPRVQ VLNQAVGDTA ERHGAILVDL YEDDTYLNPM MWSTDRLHLS       180
     SAGHRRVAAQ VLTALGVSCA DEWLLVPERP LPKPWLAART DDLRWATHHL APWLTRRLTG       240
     RSSGDTVTAK RPALTPLTD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page