(data stored in ACNUC7421 zone)

EMBL: CP000667.PE235

CP000667.PE235       Location/Qualifiers
FT   CDS             complement(268773..269156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52720"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H0"
FT                   /protein_id="ABP52720.1"
FT                   /translation="MPTTPMKSLHELGQELVTRAHEASSGRAAATLNADHRSLKQLVLA
FT                   LRAGSALSEHENPGQATLQLLSGTATVSTAEMTWHGSAGDYLVIPDRKHDLRAVSDAVV
FT                   MLTFVKDANRPEPPAAADLRSDT"
     MPTTPMKSLH ELGQELVTRA HEASSGRAAA TLNADHRSLK QLVLALRAGS ALSEHENPGQ        60
     ATLQLLSGTA TVSTAEMTWH GSAGDYLVIP DRKHDLRAVS DAVVMLTFVK DANRPEPPAA       120
     ADLRSDT                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page