(data stored in ACNUC7421 zone)

EMBL: CP000667.PE237

CP000667.PE237       Location/Qualifiers
FT   CDS             269916..271202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0237"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52722"
FT                   /db_xref="GOA:A4X1H2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H2"
FT                   /protein_id="ABP52722.1"
FT                   /translation="MEQLVRRLGVTDAVVIGLGAMLGAGVFVVFAPAAAAAGGNGLLLA
FT                   LALAGLVAFCNATSSARLAAHYPESGGTYVYGRERLGPFAGFLAGWGFVVGKTASCAAM
FT                   ALTVGAYLWPGRARLVAVVAIAAVTAVNLRGVGKTAQATKALVGVVLGVLSLVVVVGLA
FT                   GFASERIGDSGSVGGVVFSDGGGAGIHGVLTAAGLLFFAFAGYARIATLGEEVREPERT
FT                   IPRAVPLALGVVLAIYLVLAVITLGVLGPDRLAASAAPLADVVTTVGLPGLAWVVRAGA
FT                   AVAVTGVLLSLLAGVGRTLLAMARRRDVPAGLATVHRAHQVPYRAELVVAVVVAAVVLV
FT                   GDVRGAIGFSSCTVLVYYAITNASALTLGRDPGRRLPVRLLAVLGLAGCVTLAVSLPLA
FT                   SVAAGFGVLAVGAGWYALRRRYIDRSGGR"
     MEQLVRRLGV TDAVVIGLGA MLGAGVFVVF APAAAAAGGN GLLLALALAG LVAFCNATSS        60
     ARLAAHYPES GGTYVYGRER LGPFAGFLAG WGFVVGKTAS CAAMALTVGA YLWPGRARLV       120
     AVVAIAAVTA VNLRGVGKTA QATKALVGVV LGVLSLVVVV GLAGFASERI GDSGSVGGVV       180
     FSDGGGAGIH GVLTAAGLLF FAFAGYARIA TLGEEVREPE RTIPRAVPLA LGVVLAIYLV       240
     LAVITLGVLG PDRLAASAAP LADVVTTVGL PGLAWVVRAG AAVAVTGVLL SLLAGVGRTL       300
     LAMARRRDVP AGLATVHRAH QVPYRAELVV AVVVAAVVLV GDVRGAIGFS SCTVLVYYAI       360
     TNASALTLGR DPGRRLPVRL LAVLGLAGCV TLAVSLPLAS VAAGFGVLAV GAGWYALRRR       420
     YIDRSGGR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page