(data stored in ACNUC7421 zone)

EMBL: CP000667.PE238

CP000667.PE238       Location/Qualifiers
FT   CDS             complement(271253..272422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0238"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52723"
FT                   /db_xref="GOA:A4X1H3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H3"
FT                   /protein_id="ABP52723.1"
FT                   /translation="MAVYSAQQLHGLRIIVTGGGTGGHTYPALTTIRTLRARLAETGAE
FT                   PDILWVGVEQGLEARIARQEGLPFRAITTGKLRRSPNRQELWRNITDAFRIPIGVLQAM
FT                   ATVLRVRPHVVLSTGGYVSVPIGVAAWLARRPLVMHEQTLNLGLANRILALVASRVLLS
FT                   HTSSLANLSKRTQARAVVTGNPVRPDMLTGDPIAGRAAYGLEPHLPLVFVTGGAQGAVQ
FT                   VNQMVAEVLPDVLQRCQVLHQCGEYDLVRMRQVAAQLPTHLQARYRVVDYIHGQLPDVL
FT                   AAADIVVARSGAGTVAELTALGRPAILIPLVPTSGDEQRQTARYLAEAGAVRMLTGGDA
FT                   TGAALRAELLTLLDDAPYRHALAEAARRHGRPDAAAAAVTELIDAARRG"
     MAVYSAQQLH GLRIIVTGGG TGGHTYPALT TIRTLRARLA ETGAEPDILW VGVEQGLEAR        60
     IARQEGLPFR AITTGKLRRS PNRQELWRNI TDAFRIPIGV LQAMATVLRV RPHVVLSTGG       120
     YVSVPIGVAA WLARRPLVMH EQTLNLGLAN RILALVASRV LLSHTSSLAN LSKRTQARAV       180
     VTGNPVRPDM LTGDPIAGRA AYGLEPHLPL VFVTGGAQGA VQVNQMVAEV LPDVLQRCQV       240
     LHQCGEYDLV RMRQVAAQLP THLQARYRVV DYIHGQLPDV LAAADIVVAR SGAGTVAELT       300
     ALGRPAILIP LVPTSGDEQR QTARYLAEAG AVRMLTGGDA TGAALRAELL TLLDDAPYRH       360
     ALAEAARRHG RPDAAAAAVT ELIDAARRG                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page