(data stored in ACNUC7421 zone)

EMBL: CP000667.PE24

CP000667.PE24        Location/Qualifiers
FT   CDS             28458..29039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0024"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52509"
FT                   /db_xref="GOA:A4X0V9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V9"
FT                   /protein_id="ABP52509.1"
FT                   /translation="MGSGRRRSRKDEILGIAVGLFAARGYHGVSMDDIGAAAGVTGPAL
FT                   YHHFAGKEAMLVAALIPVSEGLLAGGRERAAAHPDDPRAALESLIEFHVDFALAQPAVI
FT                   ALHLHELDRLPEQPRRRIRRLQRLYVEEWVSVLTASHPGLSDNEARVLAHAAFGLMNST
FT                   PFLGGEVDRQRRAELLRGATLAALLAPTAR"
     MGSGRRRSRK DEILGIAVGL FAARGYHGVS MDDIGAAAGV TGPALYHHFA GKEAMLVAAL        60
     IPVSEGLLAG GRERAAAHPD DPRAALESLI EFHVDFALAQ PAVIALHLHE LDRLPEQPRR       120
     RIRRLQRLYV EEWVSVLTAS HPGLSDNEAR VLAHAAFGLM NSTPFLGGEV DRQRRAELLR       180
     GATLAALLAP TAR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page