(data stored in ACNUC7421 zone)

EMBL: CP000667.PE242

CP000667.PE242       Location/Qualifiers
FT   CDS             275688..277694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0242"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52727"
FT                   /db_xref="GOA:A4X1H7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H7"
FT                   /protein_id="ABP52727.1"
FT                   /translation="MRHMTGPFDRAWWTGRRLRGNSDPWAHYVVCGHDALAYWVVRSLL
FT                   ATEPQLARIRITLVVPERQRTDSPDGRDLDGIEVIRADRLDEVTFRDARLDRAEGLALL
FT                   HQDDVGNMHAALCAQEVQPRLRLVVRMFNTSLANGVRQIFPDSAVLSDAAMAAPAFVAA
FT                   ALGEVAPAHFRHGGRTLYVARRVDLRDEDIVCPVADIRDPREVRVLPADETSADVVLAE
FT                   AAGTPPGTEVAARRLRRARRWRRPVTMLLRAVRGFATRRIGLAVLVLLAVIVVLGGLYA
FT                   STAEVSWGEALYLTLVTALSGQDPDAAKPLGEQVLQVVLNLSGLALIPLVTAVVVDGLV
FT                   NARLALHSGRPLTDRSGHVVVVGLGNIGTRVTAQLRDFGVEVVAIDKNADARGAELARR
FT                   LGVPLVVGDASTEETLRAASVGTCQALVVVSTDDGVNLRAALTARSFNDDVQVVLRLFD
FT                   GHFAERVQRSFGIGVSRSVSYLAAPSFAGALLDRAVIATISVGRHALLVTEVPVAAGSS
FT                   LDGQPLATVDRTGSVRLLAHARSGQRYEWELDRRLVIMAGDRLTVVARRAGLNALLREA
FT                   GPLNPEVPASPDGSSPEPASTPAGSPPVGSSPETASLPQPASPPVGSSPEAPSSPEVAS
FT                   PSEGSSAPAGPPLPRLPEGEVGGSVDQRPVSSE"
     MRHMTGPFDR AWWTGRRLRG NSDPWAHYVV CGHDALAYWV VRSLLATEPQ LARIRITLVV        60
     PERQRTDSPD GRDLDGIEVI RADRLDEVTF RDARLDRAEG LALLHQDDVG NMHAALCAQE       120
     VQPRLRLVVR MFNTSLANGV RQIFPDSAVL SDAAMAAPAF VAAALGEVAP AHFRHGGRTL       180
     YVARRVDLRD EDIVCPVADI RDPREVRVLP ADETSADVVL AEAAGTPPGT EVAARRLRRA       240
     RRWRRPVTML LRAVRGFATR RIGLAVLVLL AVIVVLGGLY ASTAEVSWGE ALYLTLVTAL       300
     SGQDPDAAKP LGEQVLQVVL NLSGLALIPL VTAVVVDGLV NARLALHSGR PLTDRSGHVV       360
     VVGLGNIGTR VTAQLRDFGV EVVAIDKNAD ARGAELARRL GVPLVVGDAS TEETLRAASV       420
     GTCQALVVVS TDDGVNLRAA LTARSFNDDV QVVLRLFDGH FAERVQRSFG IGVSRSVSYL       480
     AAPSFAGALL DRAVIATISV GRHALLVTEV PVAAGSSLDG QPLATVDRTG SVRLLAHARS       540
     GQRYEWELDR RLVIMAGDRL TVVARRAGLN ALLREAGPLN PEVPASPDGS SPEPASTPAG       600
     SPPVGSSPET ASLPQPASPP VGSSPEAPSS PEVASPSEGS SAPAGPPLPR LPEGEVGGSV       660
     DQRPVSSE                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page