(data stored in ACNUC7421 zone)

EMBL: CP000667.PE244

CP000667.PE244       Location/Qualifiers
FT   CDS             278504..279769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52729"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H9"
FT                   /protein_id="ABP52729.1"
FT                   /translation="MPNHAGRRSGGGGRKLGSVRITSALVDPALLDLPWSTPLVEWPAQ
FT                   HLVALPQGISRHVVRFVRLGGYVYAVKETGERVAEREYDLLRALERIDFPTVEAVAIVA
FT                   DRQTEAGEPLDPVLITRHLQFSLPYRALFSHTLRPETMQRLLDALAALLVRMHLTGFFW
FT                   GDCSLSNTLFRRDAGAFAAYLVDAETGVLHRSLSNGQRGEDLEIARVNIFGEALDLQAA
FT                   GLLHESIDPAVVCEEVVQRYERLWHEITYEQQIEREARHDIEGRIRALNELGFDVAEIA
FT                   VSTIDDGRYLVRPKVVDAGYHTRRLLRLTGLDAEENQARRLLNDLDAYRAESDLIDEQQ
FT                   AAHRWLTEVFEPVVRAVPAHLRRKLEPQEIFAQIIEHKWLLSQRAGRDVGMAPAVQSYL
FT                   GDVLVHRPDEQAVLGVEIPPAG"
     MPNHAGRRSG GGGRKLGSVR ITSALVDPAL LDLPWSTPLV EWPAQHLVAL PQGISRHVVR        60
     FVRLGGYVYA VKETGERVAE REYDLLRALE RIDFPTVEAV AIVADRQTEA GEPLDPVLIT       120
     RHLQFSLPYR ALFSHTLRPE TMQRLLDALA ALLVRMHLTG FFWGDCSLSN TLFRRDAGAF       180
     AAYLVDAETG VLHRSLSNGQ RGEDLEIARV NIFGEALDLQ AAGLLHESID PAVVCEEVVQ       240
     RYERLWHEIT YEQQIEREAR HDIEGRIRAL NELGFDVAEI AVSTIDDGRY LVRPKVVDAG       300
     YHTRRLLRLT GLDAEENQAR RLLNDLDAYR AESDLIDEQQ AAHRWLTEVF EPVVRAVPAH       360
     LRRKLEPQEI FAQIIEHKWL LSQRAGRDVG MAPAVQSYLG DVLVHRPDEQ AVLGVEIPPA       420
     G                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page