(data stored in ACNUC7421 zone)

EMBL: CP000667.PE246

CP000667.PE246       Location/Qualifiers
FT   CDS             complement(280917..281882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0246"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52731"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I1"
FT                   /protein_id="ABP52731.1"
FT                   /translation="MSSGAPGAPNGTPDRHQVVVAIDVGGSRMKCALVHRDGTVARIEH
FT                   HPTQTARGPAAVVDTILDIAEALADTARHEGLAPVAFGLAVPGVIDEAAGVAIWSSNLG
FT                   FREVPLRTLATARLGMPAVLGHDVRVGGVAEARLGAGRADRHVLFVAIGTGIAAAHVVD
FT                   GTAAAGAHGAAGELGHVLVRPGGPRCGCGRAGCLEAIASAAAVARRYAELTDSTPGLSA
FT                   AEVVAHATAGDPLAQQVWTEAVEALADGLAIGQTLFDVETVVLGGGLARAGAQLLDPLR
FT                   AALHDRMTFHREPRLVPAALGAEAGCLGAALLALDSLEKR"
     MSSGAPGAPN GTPDRHQVVV AIDVGGSRMK CALVHRDGTV ARIEHHPTQT ARGPAAVVDT        60
     ILDIAEALAD TARHEGLAPV AFGLAVPGVI DEAAGVAIWS SNLGFREVPL RTLATARLGM       120
     PAVLGHDVRV GGVAEARLGA GRADRHVLFV AIGTGIAAAH VVDGTAAAGA HGAAGELGHV       180
     LVRPGGPRCG CGRAGCLEAI ASAAAVARRY AELTDSTPGL SAAEVVAHAT AGDPLAQQVW       240
     TEAVEALADG LAIGQTLFDV ETVVLGGGLA RAGAQLLDPL RAALHDRMTF HREPRLVPAA       300
     LGAEAGCLGA ALLALDSLEK R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page