(data stored in ACNUC7421 zone)

EMBL: CP000667.PE248

CP000667.PE248       Location/Qualifiers
FT   CDS             282993..283778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0248"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52733"
FT                   /db_xref="GOA:A4X1I3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I3"
FT                   /protein_id="ABP52733.1"
FT                   /translation="MDRYARWNALLEMLTDSGRVSVEGAAERLAVSQATIRRDFDQLAQ
FT                   QQMITRTRGGAVANGVSYDLPLRYKSAKHSAEKQRIGAAAAALVSPGTVVGLNGGTTST
FT                   EVARALAVRPDLNTSAEGAQLTVVTNALNIANELLVRSRMKVVVAGGVVRPKSFELVGP
FT                   LGGALLREVTLDVALLGVDAVDPQLGAAAHHEGEAAMNSLMVARAKRVVVIADSSKLGG
FT                   HAFARICPVDRMETLVTDSGAAPEVVAAFRAADVQVVCA"
     MDRYARWNAL LEMLTDSGRV SVEGAAERLA VSQATIRRDF DQLAQQQMIT RTRGGAVANG        60
     VSYDLPLRYK SAKHSAEKQR IGAAAAALVS PGTVVGLNGG TTSTEVARAL AVRPDLNTSA       120
     EGAQLTVVTN ALNIANELLV RSRMKVVVAG GVVRPKSFEL VGPLGGALLR EVTLDVALLG       180
     VDAVDPQLGA AAHHEGEAAM NSLMVARAKR VVVIADSSKL GGHAFARICP VDRMETLVTD       240
     SGAAPEVVAA FRAADVQVVC A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page