(data stored in ACNUC7421 zone)

EMBL: CP000667.PE256

CP000667.PE256       Location/Qualifiers
FT   CDS             290727..293573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: alpha/beta hydrolase fold; peptidase S15; ABC
FT                   transporter related; X-Pro dipeptidyl-peptidase C-terminal
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52741"
FT                   /db_xref="GOA:A4X1J1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J1"
FT                   /protein_id="ABP52741.1"
FT                   /translation="MRSPSPAAWVRRVLPTRRRALAAAVVVVLLAAGVVAGTLRPSEPD
FT                   LRTEAALVTVRSGPTGDEPVELDTTLYLPPAATADAPVPAVLLGHGFGGTKESVRADAE
FT                   EFADRGYAVLTWTARGFGRSGGQIHLDHPDYEVRDAQRLLDWLAARPEVVTDAAGDPRV
FT                   GVVGGSYGGALALLLAAQDQRVDAIVPMITWNDLARSFLPENSGEGPEQGVFKKGWAGL
FT                   FFGSGGNAGPASVGGSGPAGGLAPGGGSVPGGSLPENAATAAGAIDPSCGRFAADVCAA
FT                   YLRIATTGRADPDAVALLRRSSPAGKLDRIEAPTLLVQGAADTLFPLSEADANARGIAA
FT                   TGTPVQVAWFTGGHDGGDGPKTDSDRVRNLTVRWLDHYVKGEGAAPADDFTFSRIAGFD
FT                   ALDRGLVASGFRATGYPGLTGTDQRPVSVSGPAQSIANPPAGNPAAISSVPFAGDLSSL
FT                   LDGVAGDIPGQHARFESAPLPAAVDVVGAPTVSIRAASPTGTAVLFVKLYDVDAGGSAT
FT                   LPNGLVAPIRLEGLPAAVEDAEPVTVTLPAIVRRIEAGHRLRVVVATSDQAYATPVEPA
FT                   VYSVALASEAVTLPTVASEPIPTDAVVWRWVLVGLLAAIVVGLVVVVAVLRHRHRRRES
FT                   RVHPTYAGVPLAVRDLRKEYADGFVAVSNVDFEVHHGQVVGLLGPNGAGKTTTLRVLMG
FT                   LTQPTAGEVYVFGHRLVPGAPVLSRIGALVEGPGFLPHLSGLDNLKAYWRATGRPWADA
FT                   HFDEALEIAGLGTSVHRKVRTYSHGMRQRLAIAQAMLGLPELLVLDEPTDGLDPPQIAE
FT                   MRRVLLRYATGGRAVLVSSHLLAEVEQTCTHAVVVNKGQIVASGPVEEIVGESPSVLIE
FT                   VTDPVAAREVLDRLTGVSVLPDGDGQLVVDTNGTARSEVVAELVRAGIGVDRVVPRRRL
FT                   EDAFLALVGDNSRGSGDR"
     MRSPSPAAWV RRVLPTRRRA LAAAVVVVLL AAGVVAGTLR PSEPDLRTEA ALVTVRSGPT        60
     GDEPVELDTT LYLPPAATAD APVPAVLLGH GFGGTKESVR ADAEEFADRG YAVLTWTARG       120
     FGRSGGQIHL DHPDYEVRDA QRLLDWLAAR PEVVTDAAGD PRVGVVGGSY GGALALLLAA       180
     QDQRVDAIVP MITWNDLARS FLPENSGEGP EQGVFKKGWA GLFFGSGGNA GPASVGGSGP       240
     AGGLAPGGGS VPGGSLPENA ATAAGAIDPS CGRFAADVCA AYLRIATTGR ADPDAVALLR       300
     RSSPAGKLDR IEAPTLLVQG AADTLFPLSE ADANARGIAA TGTPVQVAWF TGGHDGGDGP       360
     KTDSDRVRNL TVRWLDHYVK GEGAAPADDF TFSRIAGFDA LDRGLVASGF RATGYPGLTG       420
     TDQRPVSVSG PAQSIANPPA GNPAAISSVP FAGDLSSLLD GVAGDIPGQH ARFESAPLPA       480
     AVDVVGAPTV SIRAASPTGT AVLFVKLYDV DAGGSATLPN GLVAPIRLEG LPAAVEDAEP       540
     VTVTLPAIVR RIEAGHRLRV VVATSDQAYA TPVEPAVYSV ALASEAVTLP TVASEPIPTD       600
     AVVWRWVLVG LLAAIVVGLV VVVAVLRHRH RRRESRVHPT YAGVPLAVRD LRKEYADGFV       660
     AVSNVDFEVH HGQVVGLLGP NGAGKTTTLR VLMGLTQPTA GEVYVFGHRL VPGAPVLSRI       720
     GALVEGPGFL PHLSGLDNLK AYWRATGRPW ADAHFDEALE IAGLGTSVHR KVRTYSHGMR       780
     QRLAIAQAML GLPELLVLDE PTDGLDPPQI AEMRRVLLRY ATGGRAVLVS SHLLAEVEQT       840
     CTHAVVVNKG QIVASGPVEE IVGESPSVLI EVTDPVAARE VLDRLTGVSV LPDGDGQLVV       900
     DTNGTARSEV VAELVRAGIG VDRVVPRRRL EDAFLALVGD NSRGSGDR                    948
//

If you have problems or comments...

PBIL Back to PBIL home page