(data stored in ACNUC7421 zone)

EMBL: CP000667.PE257

CP000667.PE257       Location/Qualifiers
FT   CDS             293573..294472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52742"
FT                   /db_xref="GOA:A4X1J2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J2"
FT                   /protein_id="ABP52742.1"
FT                   /translation="MARTTVEPGTGDSGGTPSGAAAGYRPFATLPFGAEFRRQASRRRT
FT                   QLALGFLVLLPLIILIAFQFGSDDDDNGRGEFGSLVEFATSGGLNFTLFTLFVSASFLL
FT                   VVVVALFCGDTVASEASWGSLRYLLAVPVPRARLLAVKLLVALTYSGMALLLLAGTALL
FT                   LGTVRYGWEPLRSTVAAELEPGEGLLRLLAVLGYLAVVLLVVAGLAVLLSVSTDAALGA
FT                   VGGAVLLWILSSILDQITALGVLRTFLPTHYSTAWLGLLSTPIQTDDVVRGAISAISYA
FT                   TLFWGLAFWRFTRKDIVS"
     MARTTVEPGT GDSGGTPSGA AAGYRPFATL PFGAEFRRQA SRRRTQLALG FLVLLPLIIL        60
     IAFQFGSDDD DNGRGEFGSL VEFATSGGLN FTLFTLFVSA SFLLVVVVAL FCGDTVASEA       120
     SWGSLRYLLA VPVPRARLLA VKLLVALTYS GMALLLLAGT ALLLGTVRYG WEPLRSTVAA       180
     ELEPGEGLLR LLAVLGYLAV VLLVVAGLAV LLSVSTDAAL GAVGGAVLLW ILSSILDQIT       240
     ALGVLRTFLP THYSTAWLGL LSTPIQTDDV VRGAISAISY ATLFWGLAFW RFTRKDIVS        299
//

If you have problems or comments...

PBIL Back to PBIL home page