(data stored in ACNUC7421 zone)

EMBL: CP000667.PE258

CP000667.PE258       Location/Qualifiers
FT   CDS             complement(294503..294862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52743"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J3"
FT                   /protein_id="ABP52743.1"
FT                   /translation="MPGSGRYATRGRAGRPRPPRRRPRPNPYRKDVTTMIHRARRLFSS
FT                   QVRAATFARRRWRGLDPEQVYAYLDRVADELERLTREATTARAEGELIRQALRQWQSRH
FT                   AGCQHATTPNSRWHR"
     MPGSGRYATR GRAGRPRPPR RRPRPNPYRK DVTTMIHRAR RLFSSQVRAA TFARRRWRGL        60
     DPEQVYAYLD RVADELERLT REATTARAEG ELIRQALRQW QSRHAGCQHA TTPNSRWHR        119
//

If you have problems or comments...

PBIL Back to PBIL home page