(data stored in ACNUC7421 zone)

EMBL: CP000667.PE259

CP000667.PE259       Location/Qualifiers
FT   CDS             295198..295434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0259"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52744"
FT                   /db_xref="GOA:A4X1J4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J4"
FT                   /protein_id="ABP52744.1"
FT                   /translation="MPHAVPLWRVIRDDLRARIKAGILKPGDKLPSTRELADQYETSPV
FT                   TVRKAVDILIESGELLGRQGMGVFVAIPPASDR"
     MPHAVPLWRV IRDDLRARIK AGILKPGDKL PSTRELADQY ETSPVTVRKA VDILIESGEL        60
     LGRQGMGVFV AIPPASDR                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page